General Information

  • ID:  hor002181
  • Uniprot ID:  P67971
  • Protein name:  Insulin B chain
  • Gene name:  INS
  • Organism:  Saimiri sciureus (Common squirrel monkey)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Saimiri (genus), Saimiriinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVNQHLCGPHLVEALYLVCGERGFFYAPKT
  • Length:  30
  • Propeptide:  FVNQHLCGPHLVEALYLVCGERGFFYAPKTGVVDQCCTSICSLYQLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P67971-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002181_AF2.pdbhor002181_ESM.pdb

Physical Information

Mass: 392743 Formula: C159H234N40O40S2
Absent amino acids: DIMSW Common amino acids: L
pI: 7.42 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: 27.67 Boman Index: -870
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 87.67
Instability Index: 2699 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  2263627
  • Title:  Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.